İhtiyacınıza ve yetkinliğine özel web tasarım üreten Farika'ya gelin, size özel demo üretelim, sadece web sitenizden memnun kalırsanız ücret ödeyin!

2.54 Rating by CuteStat

farikawebtasarim.com is 5 years 5 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, farikawebtasarim.com is SAFE to browse.

PageSpeed Score
53
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

77.92.140.32

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948
Farika Web Tasarım - Önce beğenin, sonra ödeyin.

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: 13 H4 Headings: 2
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 16
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 77.92.140.32)

Kötü Sözlük'tü.

- kotusozluk.com
4,085,720 $ 240.00

Tam Haber | Güncel Haberler ve Son Dakika Haberleri

- tamhaber.com.tr

Tüm sosyal medya, gazete ve internet haberleri, köşe yazarları, son dakika haberler ve halk için habercilik anlayışı ile Türkiye'nin gerçek haber sitesi.

7,102,027 $ 240.00

Index of /

- chicopeekedikopekmamalari.com
Not Applicable $ 8.95

Maya Cupcake | Harika Cupcake Çeşitleri

- mayacupcake.com

Doğumgünü, düğün ve özel gün cupcake çeşitlerimiz ile karşınızdayız.

19,998,643 $ 8.95

Index of /

- tuvalettikanikligiacmafiyatlari.net
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 14 Jan 2019 14:06:23 GMT
Server: Apache
Link: <https://farikawebtasarim.com/wp-json/>; rel="https://api.w.org/", <https://wp.me/PaBawc-17>; rel=shortlink
Upgrade: h2,h2c
Connection: Upgrade
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: FBS Inc.
Registration Date: Jan 11, 2019, 12:00 AM 5 years 5 months 1 week ago
Last Modified: Jan 11, 2019, 12:00 AM 5 years 5 months 1 week ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.kotuhost.com 212.68.61.245 Türkiye Türkiye
ns2.kotuhost.com 212.68.61.231 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
farikawebtasarim.com A 10783 IP: 77.92.140.32
farikawebtasarim.com NS 86400 Target: ns1.kotuhost.com
farikawebtasarim.com NS 86400 Target: ns2.kotuhost.com
farikawebtasarim.com SOA 10783 MNAME: ns1.kotuhost.com
RNAME: mesutbilgili.outlook.com
Serial: 2019011104
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
farikawebtasarim.com MX 14400 Target: farikawebtasarim.com

Full WHOIS Lookup

Domain Name: FARIKAWEBTASARIM.COM
Registry Domain ID: 2351443443_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.isimtescil.net
Registrar URL: http://www.isimtescil.net
Updated Date: 2019-01-11T12:40:37Z
Creation Date: 2019-01-11T12:39:40Z
Registry Expiry Date: 2020-01-11T12:39:40Z
Registrar: FBS Inc.
Registrar IANA ID: 1110
Registrar Abuse Contact Email: abuse@domaintime.biz
Registrar Abuse Contact Phone: +90.8502000444
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.KOTUHOST.COM
Name Server: NS2.KOTUHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-01-14T14:06:22Z